Monday, August 24, 2020
Analysis of the fashion industry, Assignment Example | Topics and Well Written Essays - 2500 words
Examination of the design business, - Assignment Example Style weeks held in the US gets gigantic measure of cash into the countryââ¬â¢s save. Then again, the UK design industry is worth à £26 billion (Pithers, 2014). Indeed, even in the UK, this industry represents high number of employments. Report expresses that during the London Fashion Week, more than à £100 million of requests are set. In style industry, the market is portioned by brands, which is commonly worried about imagination associated with the item plan and another according to advertise, which again is dictated by cost of the item that the buyer is eager to pay. The apparel that are made in manufacturing plant setting and not by hand are alluded as prepared to-wear (RTW). They are likewise sold in the market in standard sizes (Dââ¬â¢Aveni, 2010). These fabrics are fabricated so shoppers can wear them without unreasonable adjustment attributable to the standard sizes. Then again, dissemination line is made by very good quality style brands or style architects. These are auxiliary stocks, which are accessible in the market at lower costs. This aides in expanding deals volume as the client base gets more extensive with bringing down of the cost. By utilizing attractive quality of the superior reaches, originators effectively tap the market through a radiance impact (Dââ¬â¢Aveni, 2010). If there should arise an occurrence of RTW garments, the buyersââ¬â¢ needs are dealt with as sizes offered are normalized in nature and fit appropriately to dominant part of people. These garments barely require any modification, which implies the item is accessible to shoppers at the ideal time. For the most part, this is trailed by all style marks at present. The dissemination, despite what might be expected, is to build the buyer base as brands start an optional product line, which is sold at lower costs than the essential one. There are takers for chic stocks if accessible at reasonable cost. The brands know about the equivalent, which is the reason they have taken the way of
Saturday, August 22, 2020
Renaissance Art Research Paper Essay Example
Renaissance Art Research Paper Essay Renaissance workmanship was conceived in the second 50% of the fourteenth century and kept on creating all through the fifteenth and sixteenth hundreds of years, bit by bit covering in a steady progression, all the nations of Europe. Renaissance workmanship mirrored the particular idea of the transitional age. Renaissance, which was firmly connected to Florence and its general public, is without a doubt one of the most energizing throughout the entire existence of Western human progress. It not just demonstrated the world an entire universe of specialists and humanist masterminds, yet at the same time adds to the advancement of logical idea, the arrangement of high culture, and is an incredible educator of the delightful. Development of another culture has become an issue essentially humanistic savvy people, in their starting point and economic wellbeing rather diverse and heterogeneous. Thoughts, set forward by humanists, were hard to portray as ââ¬Å"bourgeoisâ⬠or ââ¬Å"early bourgeois.â⬠In the way of life of the Italian Renaissance there was established the core of another standpoint, the particular highlights that characterized Renaissance. It was produced by the new requests of life itself, as humanists anxiously looked for accomplishing more significant levels of training for an adequately wide area of society. We will compose a custom exposition test on Renaissance Art Research Paper explicitly for you for just $16.38 $13.9/page Request now We will compose a custom article test on Renaissance Art Research Paper explicitly for you FOR ONLY $16.38 $13.9/page Recruit Writer We will compose a custom article test on Renaissance Art Research Paper explicitly for you FOR ONLY $16.38 $13.9/page Recruit Writer The starting point of requirements of the new humanistic viewpoint is all the more explicitly connected with dynamic propensities in the advancement of profound culture of Europe 12-13 centuries. Urban non-church schools and established on their premise colleges turned into the focal point of common information, mirroring the necessities of social turn of events. In the early Renaissance, the inquiry started to emerge of how mainstream or open craftsmanship ought to be, the manner by which human-centric, what was the manââ¬â¢s place in it. Dexterous brush, complex sythesis, point of view (three-dimensional artistic creation), shading, light, brilliance, light and shadow, feeling and painstakingness in the work these were the fundamental qualities of Renaissance craftsmanship. Fanciful and scriptural characters were fundamental to the craftsmen of the period. The human body was the primary wellspring of motivation and the object of study in the specialty of the Renaissance. Likeness with reality has arrived at such a degree, that the characters portrayed in progress, appeared to be alive not at all like introduced by the specialty of the twentieth century, where, for instance, in an artistic creation by Georges Seurat individuals are increasingly similar to fossils. For specialists and researchers the human body was a vast source. They continually improve their insight and abilities by examining the human body. Physical flawlessness mirrored the common view at that point, that man was made in the picture and resemblance of God. The divine beings were truly exemplified and portrayed as individuals with highlights that were intrinsic in an individual, in contrast to the masterpieces of the Middle Ages. Understudies looking to set up an OK examine proposition should utilize free model renaissance workmanship inquire about paper. These free example can be an incredible wellspring of important information whenever composed appropriately. It is safe to say that you are searching for a first rate custom research paper on Renaissance Art subjects? Is privacy as critical to you as the high caliber of the item? Attempt our composing administration at EssayLib.com! We can offer you proficient help at reasonable rates. Our accomplished PhD and Masterââ¬â¢s essayists are prepared to consider your littlest requests. We promise you 100% legitimacy of your paper and guarantee you of dead on time conveyance. Continue with the request structure: If you don't mind don't hesitate to visit us at EssayLib.com and get familiar with our administration!
Saturday, July 18, 2020
Sample on the Great Depression in the USA
Sample on the Great Depression in the USA The Great Depression in the United States Jan 11, 2019 in History Introduction The period that lasted from 1929 to 1939 is considered to be the years of the Great Depression in the United States. Moreover, this global depression is named as a world economic crisis. The depression touched upon not only the US, but also Canada, Germany, Great Britain and France. Thus, it is interesting to find out in what way the depression occurred in two continents. Obviously, this great crisis was caused by some serious reasons. First of all, strong deflation provoked financial unsteadiness, business interruption of many enterprises, credit defaults. As the result, unemployment rates rose tremendously. Industrial production dropped to the level of the beginning of the XX century. There were about 30 million of people out of work in the industrialized countries with developed market economies (Beaudreau, 2014). Nearly a hundred years ago Emerson asked, Can anybody remember when the times were not hard and money not scarce? As the rule, nobody knows the answer to this question. Besides, economists have not reached a consensus on the causes of the Great Depression. Thus, were there any differences between European and American Depression? Can it be considered a kind of regular process in the world? The Analysis of the Period of the Great Depression To begin with, itis necessary to clarify what exactly the Great Depression meant for American nation. As it was already mentioned, this crisis had a huge impact on peoples lives. During 1929-1939, deteriorated farmers, small traders and the middle class were below the poverty line. From 25 to 90 % of children suffered from malnutrition throughout the country. Nevertheless, one should not forget that this period was not the only one during which the state faced such difficulties. R. Duffers (1932) mentioned in his article that hard times dated back to the years 1837, 1873, 1893, perhaps, 1907 and 1921, and of course 1929. It can, thus, be suggested that the phenomenon of the Great Depression is a kind of a regular process.
Thursday, May 21, 2020
Quebrada Jaguay - Terminal Pleistocene Archaeology
Quebrada Jaguay (designated QJ-280 by its excavator) is a multi-component archaeological site, located on anà alluvial terrace within the coastal desert of southern Peru, on the north bank an ephemeral stream near the town of Camanà ¡. At the time of its earliest occupation, it was about 7-8 kilometers (4-5 miles) in from the Peruvian coast and today is about 40 meters (130 feet) above sea level. The site was a fishing community, with a Terminal Pleistocene occupation date between about 13,000 and 11,400 calendar years ago (cal BP), based on a large suite of radiocarbon dates. Terminal Pleistocene sites are known inà Andean chronology as Preceramic Period I). The site is one of about 60 sites which have been found along the coast of Peru in this region, but it is the only one containing the Jaguay Phase occupations, and it is the earliest site in the region found to date (as of 2008, Sandweiss). The closest site with the same date is Quebrada Tacahuay, some 230 km (140 miles) to the south. It, like Quebrada Jaguay, is a seasonally-occupied fishing village: and those sites and many others extending from Alaska to Chile support the Pacific Coast Migration Model for the original colonization of the Americas. Chronology Late Preceramic Period, 4000 cal BP, Manos PhaseHiatus, 4000-8000 cal BPEarly Middle Preceramic Period, 8000-10,600 cal BP, Machas PhaseEarly Preceramic Period, 11,400-13,000 cal BP, Jaguay Phase During the Jaguay phase, the site was a seasonally-occupied coastal base camp for hunter-gatherers and fishermen who targeted mostly drum fish (Sciaenae, corvina or sea bass family), wedge clams (Mesodesma donancium), and freshwater and/or marine crustaceans. The occupations apparently were confined to the late winter/early summer months; the rest of the year, the people are believed to have moved inland and hunted terrestrial animals. Based on the size of the fish, the people were net fishing: the Machas phase occupations contain a few specimens of knotted cordage. The only terrestrial animals recovered from the site were small rodents, which were not likely food for the residents. Houses during the Jaguay phase were rectangular, based on the identification of postholes, and contained hearths; the houses were reconstructed several times in the same location but slightly different positions, evidence for seasonal occupations. Food remains and abundant lithic debitage were also recovered, but there were almost no finished tools. Poorly preserved plant remains were restricted to a few prickly pear cactus (Opuntia) seeds. The vast majority of the raw material for the stone tools (lithics) were local, but Alca obsidian identified by Instrumental Neutron Activation Analysis had been brought from its Pucuncho basin source in the Andean highlands some 130 km (80 mi) away and 3000 m (9800 ft) higher in elevation. Machas Phase The Machas Phase occupation at the site contains neither prickly pear nor obsidian: and during this period there are many more such villages in the region. The Machas phase occupation included several bottle gourd rind fragments; and a single semi-subterranean house, about 5 m (16 ft) in diameter and built with a foundation of mud and stone. It may have been roofed with wood or other organic material; it had a central hearth. The house depression is filled with a shell midden, and the house was also built on top of another shell midden. Archaeological Discovery Quebrada Jaguay was discovered by Frà ©dà ©ric Engel in 1970, as part of his investigations into the preceramic epoch along the coastline. Engel dated charcoal from one of his test pits, which came back to a remarkable 11,800 cal bp, unheard of at the time: in 1970, any site in the Americas older than 11,200 was considered heresy. Excavations were conducted at the site by Daniel Sandweiss in the 1990s, with a team of Peruvian, Canadian and U.S archaeologists. Sources Sandweiss DH. 2008. Early Fishing Societies in Western South America. In: Silverman H, and Isbell W, editors. The Handbook of South American Archaeology: Springer New York. p 145-156. Sandweiss DH, McInnis H, Burger RL, Cano A, Ojeda B, Paredes R, Sandweiss MdC, and Glascock MD. 1998. Quebrada Jaguay: early South American maritime adaptations. Science 281(5384):1830-1832. Sandweiss DH, and Richardson JBI. 2008. Central Andean Environments. In: Silverman H, and Isbell WH, editors. The Handbook of South American Archaeology: Springer New York. p 93-104. Tanner BR. 2001. Lithic Analysis of Chipped Stone Artifacts Recovered from Quebrada Jaguay, Peru. Electronic Theses and Dissertations: University of Maine.
Wednesday, May 6, 2020
Standardized Testing The Real Threat to American Schools...
Standardized testing requires student to answer same or similar questions with given answer choices that are often in multiple choice or true or false form. Dating back from 2200 B.C standardized testing is recorded being used in China ,where people applying for government jobs had to take an examination ,testing their knowledge on confucian philosophy and poetry.During the mid-1800s in Industrial Revolution ,soon after child labor laws were enacted taking children out of farms and factories and putting them into schools the use of standardized test was introduced to America in Boston. Standardized testing was being used to compare schools and teaching quality; Bostonââ¬â¢s program was soon adopted nation wide. Types of standardized testâ⬠¦show more contentâ⬠¦These forms of test either overestimate students or underestimate them. Often students that test well usually cannot explain how they got the answer they did or why it is right. Meanwhile, standardized tests are unfa ir to the students who are brilliant thinkers,but do not test well. Wrong answers do not always mean an absence of understanding , just like correct answers do not alway indicate understanding. Though multiple choice and true or false format present many problems it is easier to agree on a correct answer of a basic criteria multiple choice question than a on deeper level of thinking, essay question ,therefore making the tests easier and faster to grade.This belief that efficiency is a high priority that effectiveness is leading to a decline in teaching because standardized test do not require an reason behind answers most teachers teach for the sake of testing and sadly, not for the sake of learning. This type of teaching is often referred to as the ââ¬Ëdrill and killââ¬â¢ method and involves students memorizing isolated information that ââ¬Ëmightââ¬â¢ be on the test. This form of teaching does not allow students to understand the information in a way that they might apply it to other situations other than testing. Those students who are not taught in a ââ¬Ëdrill and killââ¬â¢ technique and can analyze and make connections are often asked to ââ¬Ëdumb do wnââ¬â¢ for theShow MoreRelatedThe Dangerous Myth Of Grade Inflation1279 Words à |à 6 PagesMyth of Grade Inflation,â⬠Alfie Kohn sets out to determine if grade inflation is indeed fact or fiction. The opening quotes provided by two professors at Harvard University separated by over century has most definitely peaked my interest. It had me questioning whether or not these professors are holding our education system to a ââ¬Å"Harvardâ⬠standard or is their actually truth to their statements; that feigned students are indeed submitting ââ¬Å"sham workâ⬠(Bergmann, 260). Kohn goes onto indicate that:Read MoreEssay about Standardized Testing Is Inaccurate For Teacher Evaluation2463 Words à |à 10 Pagesnations in the world. Over the past ten years, a new push has been made to improve education in America through programs like No Child Left Behind and Race to the Top. States across the country are assessing teachers and schools by using standardized test score s. By using standardized test scores, states link high stakes to the results such as grant money, salary, and jobs as incentive to improve the scores for the following year. In Wisconsin and other states, 50% of these evaluations are based solelyRead MoreStrategic Human Resource Management View.Pdf Uploaded Successfully133347 Words à |à 534 Pagestest. Additionally, the increased production, its contribution to profitability, and the standard deviation of the contribution, would be variables in the calculations. Finally, other variables might be included in the analysis, such as the cost of testing enough applicants to obtain a sufficient number having scores above the cut-off point.15 Brian Becker and Mark Huselidââ¬â¢s study in a national retailing company provides another example of an application of utility theory. Becker and Huselidââ¬â¢s analysisRead MoreStephen P. Robbins Timothy A. Judge (2011) Organizational Behaviour 15th Edition New Jersey: Prentice Hall393164 Wo rds à |à 1573 PagesThree Ethical Decision Criteria 187 â⬠¢ Improving Creativity in Decision Making 188 Summary and Implications for Managers 190 S A S A S A L L L Self-Assessment Library What Are My Gender Role Perceptions? 166 glOBalization! Chinese Time, North American Time 171 Myth or Science? Creative Decision Making Is a Right-Brain Activity 181 Self-Assessment Library Am I A Deliberate Decision Maker? 183 An Ethical Choice Whose Ethical Standards to Follow? 185 Self-Assessment Library How Creative Am I? 190
With reference to a case study on Brazil, explain what affects rural to urban migration Free Essays
The following essay is based on a case study of Brazil. I will describe and show the problems of rural to urban migration. The two locations we will be studying are the Caatinga and a city called Belo Horizonte, both located in Brazil (see map below). We will write a custom essay sample on With reference to a case study on Brazil, explain what affects rural to urban migration or any similar topic only for you Order Now Rural areas are areas isolated from city centers with very little communication and transport to them. They are very poor areas with little agriculture. Urban areas are city like places where communication, transport and living conditions are acceptable. The Caatinga is one of the most remote areas of Brazil. It is a dry and poor area. It is the largest dry region in South America. The vegetation in this area is very pitiable. Population Pressure happens a lot here. Many people are born and are forced to live in such disgraceful conditions. It is situated in the North-eastern part of Brazil. The Caatinga has serious problems including health and, the most important one, there is a lack of jobs. Another major problem are droughts. Approximately once every ten years, a drought occurs causing large disasters in matters of agriculture and health. Climate also plays a big role in the daily life of the Caatinga inhabitants. The other location we are going to study is Belo Horizonte. It is a town located in the south-eastern part of Brazil. Iââ¬â¢m going to concentrate on the surroundings (suburbs) of the town known as the Favelas. These are groups of houses, now changed into neighborhoods where people that migrate from the Caatinga and other rural areas of Brazil move too. Here the houses are mostly wooden shacks or the better ones are made with cement and bricks. Here there is little electricity and water. Living conditions are much better than in the Caatinga. There are more job opportunities for migrated people with no money. People that migrate to these places, in most cases leave the Caatinga with no money at all and will have to live under cardboard boxes until they can afford to build there own shack. You can read also Classifications of Restaurants The most important factor that affects migration are the Push and the Pull factors. Push factors are negative factors. These could include such things as health, education, general living conditions etc. The Pull factors are positive factors. These include things like electricity provided, clean water, better health etc. In this case study, the push factors will be about the rural areas (Caatinga). The pull factors will be about the urban area (Favelas). Migration is affected by these factors. In this study the most important ones are health, climate, job opportunities, education and living conditions. The problems that people face in the Caatinga are very serious. This is why people want to migrate or even are forced to migrate to urban places and Favelas. They do this to try and gain some money and to give better future for their children. Droughts are very common in the Caatinga. When these occur, rivers can dry up and there is no water to drink and to use for agricultural reasons. This brings every time famine, starvation and disease. People can only drink from dirty ponds formed when the last rain had fallen. Illiteracy is another great problem. There are no schools for people to go to. Most of the population cannot read nor write. Children cannot learn how to write and this is why when they migrate, they will have very underprivileged jobs with very little pay. When droughts occur, agricultural land is destroyed along side with all of the crops grown during the year. This brings long periods of time with no one working on the land which means no jobs. With no jobs, people have no money and cannot buy food nor medicines for their family. When the harvesting fails, people can only eat lamb and beans throughout the year until the next harvest is ready. There is no medical care in these areas. Diseases such as Malaria strike young children and elder people causing death rates to increase drastically. This also is connected with transport. Ill and sick people cannot be transported to cities to be taken care of. No food can be imported to the Caatinga. The population of the Caatinga can only live on what they produce, this is called subsistence farming. The climate has also a very important job in the Caatinga and is one of the biggest factors causing migration. All through out the year there is little or no rain at all in some areas of the Caatinga. The temperatures are very high in the summer (reaching over 30à ¯Ã ¿Ã ½) and in the winter are very cold (approximately 10à ¯Ã ¿Ã ½). You can read also Costco Case Study Families in the Caatinga are very large. Some families have up to 15 children and in some cases can reach 20. This is because people want to have more children so that they can be maintained when they reach an older age. Another reason is that diseases can easily kill many children. On average out of 10 children, 5 die of illnesses or starvation. In the Caatinga child labor is also a big concern for the government. Many children are used to farm on the land which isnââ¬â¢t of their property. People from the Caatinga decide to migrate to urban cities like Belo Horizonte. They have to walk for hundreds of kilometers with all of their belongings and no money. When they arrive in the Favelas, they have to set up a new life. The Favelas are situated just outside cities. These are groups of houses built by migrates coming in from the rural part of the country. Here their children can receive an education from proper schools. They learn how to read and write so that in the future they will be able to have a better job. Once they reach an older age, children will have to start working to try and get some money for their numerous family. In a case we saw, the money that the father and her daughter earned was à ¯Ã ¿Ã ½12 a month, just enough to maintain their big family. They cannot spend any of it on leisure and entertainment. With the money they can buy proper food from markets and are able to feed the whole family. They can also buy medicines and with time, they can improve their household. The birth rate here is also much lower than in the Caatinga. This is because health is much more advanced and people donââ¬â¢t need as many children to maintain them. The death rate is also much lower than in the Caatinga. Medicines to cure diseases are introduced and hospitals are nearby. Electricity and sometime running water in houses is introduced. This is a necessity for many families. The transport and communication is good here. The only problem is that there is no entertainment in these Favelas (no cinema, shops, restaurants etcâ⬠¦). The climate here is much better. The temperatures are quite high throughout the year and the rainfall is balanced. In conclusion to my essay, the urban environment is a much better place to live in because of all its pull factors. Urban population is increasing rapidly, 78% of Brazilian population lives in Urban population whilst the other 22% is spread out between rural and Amazonian. I would prefer to live in an urban environment because of all the comforts it can provide compared to the Caatinga. Still people donââ¬â¢t have power over their actions. People living in the Caatinga cannot decide weather to move or not. It is a risk they have to take and only some families can take it. It would be hard to help the population of the Caatinga. Brazil, being in some parts a developed country and in others, not developed at all, would find it difficult to provide the funds to help this population. It would need to build a new transport system, including a railway and more roads. It could also build hospital facilities and refugee camps for homeless people. It should improve agricultural facilities adding irrigating systems and it should bring, using aqueducts, water to remote villages. This could also bring problems because people living in the Caatinga might not want their land to be industrialized. Also the funds to help could be received from the population of urban cities which might disapprove. Rio de Janeiro has tried to improve living conditions of the Favelas by expanding its land and becoming the second largest city in the world. It has built on a flat piece of land tall buildings for rich people to move in. It is a much safer place for people to live in. It is actually become a new city called Barra. Barra is one of the safest cities in South America. It has the largest shopping mall in all of South America. The criminality is very low. By building this city, Rio de Janeiro has stopped growing because people move out to Barra more. Soon Barra will become as large as Rio and suffer the same problems if migration doesnââ¬â¢t stop. How to cite With reference to a case study on Brazil, explain what affects rural to urban migration, Free Case study samples
Sunday, April 26, 2020
Pornography -- Sex Or Subordination Essays - Pornography
Pornography -- Sex or Subordination? In the late Seventies, America became shocked and outraged by the rape, mutilation, and murder of over a dozen young, beautiful girls. The man who committed these murders, Ted Bundy, was later apprehended and executed. During his detention in various penitentiaries, he was mentally probed and prodded by psychologist and psychoanalysts hoping to discover the root of his violent actions and sexual frustrations. Many theories arose in attempts to explain the motivational factors behind his murderous escapades. However, the strongest and most feasible of these theories came not from the psychologists, but from the man himself, "as a teenager, my buddies and I would all sneak around and watch porn. As I grew older, I became more and more interested and involved in it, [pornography] became an obsession. I got so involved in it, I wanted to incorporate [porn] into my life, but I couldn't behave like that and maintain the success I had worked so hard for. I generated an alter-ego to fulfill my fantasies under-cover. Pornography was a means of unlocking the evil I had burried inside myself" (Leidholdt 47). Is it possible that pornography is acting as the key to unlocking the evil in more unstable minds? According to Edward Donnerstein, a leading researcher in the pornography field, "the relationship between sexually violent images in the media and subsequent aggression and . . . callous attitudes towards women is much stonger statistically than the relationship between smoking and cancer" (Itzin 22). After considering the increase in rape and molestation, sexual harassment, and other sex crimes over the last few decades, and also the corresponding increase of business in the pornography industry, the link between violence and pornogrpahy needs considerable study and examination. Once the evidence you will encounter in this paper is evaluated and quantified, it will be hard not come away with the realization that habitual use of pornographic material promotes unrealistic and unattainable desires in men that can leac to violent behavior toward women. In order to properly discuss pornography, and be able to link it to violence, we must first come to a basic and agreeable understanding of what the word pornography means. The term pornogrpahy originates from two greek words, porne, which means harlot, and graphein, which means to write (Webster's 286). My belief is that the combination of the two words was originally meant to describe, in literature, the sexual escapades of women deemed to be whores. As time has passed, this definition of pornography has grown to include any and all obscene literature and pictures. At the present date, the term is basically a blanket which covers all types of material such as explicit literature, photography, films, and video tapes with varying degrees of sexual content. For Catherine Itzin's research purposes pornogrpahy has been divided into three categories: The sexually explicit and violent; the sexually explicit and nonviolent, but subordinating and dehumanizing; and the sexually explicit, nonviolent, and nonsubordinating that is based upon mutuality. The sexually explicit and violent is graphic, showing penetration and ejaculation. Also, it shows the violent act toward a woman. The second example shows the graphic sexual act and climax, but not a violent act. This example shows the woman being dressed is a costume or being ?talked down' to in order to reduce her to something not human; such as a body part or just something to have sex with, a body opening or an orifice. Not only does ?erotica' show the entire graphic sexual act, it also depicts an attraction between two people. Her research consistently shows that harmful effects are associated with the first two, but that the third ?erotica', is harmless (22). These three categories basically exist as tools of discerning content. Although sometimes they overlap without a true distinction, as in when the film is graphic in the sexual act and also in violence, but shows the act as being a mutual activity between the people participating. In my view, to further divide pornography, it is possible to break it down into even simpler categories: soft and hard core pornography. Hard core pornography is a combination of the sexually explicit and violent and the sexually explicit and nonviolent, but subordinating and dehumanizing categories, previously discussed. Soft core pornography is thought to be harmless and falls into the category known as ?erotica'; which is the category based on mutuality. In hard core pornogrpahy, commonly rated XXX, you can see graphic depiction's of violent sexual acts usually with a man or group of men, deriving sexual gratification from the degradation of a woman. You can also see women participating in demoralizing sexual behavior among themselves for the gratification of men. In a triple-X movie all physical aspects are shown, such as extreme
Wednesday, March 18, 2020
June 6 SAT Takers Heres How You Can Retest for Free
June 6 SAT Takers Here's How You Can Retest for Free SAT / ACT Prep Online Guides and Tips The College Board is going to allow students who were affected by the mistake on the June 6, 2015 administration of the SAT to re-take the test for free in October. Read on for more information and to see what your options are. A Bit of Background: What Happened on June 6th? June 6 was the final SAT testing date for the 2014-2015 school year, and hundreds of thousand of students across the country registered to take the test. On test day, many were surprised to see that instead of the standard 20 minutes allowed for Section 8 or Section 9, their test booklets instructed they should be allowed 25 minutes. The proctors' instructions, however, still stated the time allowance should be 20 minutes. Therefore,some students got the correct amount of time on both sections, others were given 25% extra time, and still more were given something in between,which overall created a very confusing situation for everyone involved. Of the hundreds of thousands registered, almost all students were affected, apart from those taking the SAT with accommodations. (International test takers were not affected.) For a full breakdown of what happened, see our article here. The Aftermath and the Demand for a Retest After the test, students were very concerned about what would happen with their test results. They were worried that their scores would be invalidated,because the test was no longer standardized compared to other administrations of the SAT.Many worried that colleges would not accept their scores as equal to those from other testing dates. In the days following the exam, the College Boardgave a lot of conflicting information to different people.It told some thatthere would be a retest,but told others thatthe affected section of the exam would be thrown out. Two days later, they finally released an offical statement, in which they announced that they would proceed with scoring the exams,with the TWO affected sections removed.They claimed that they would be able to do this and still provide"reliable scores." Understandably, many students were angered by this response - it was obvious that this was decided on because it is theeasiest and cheapest way for the College Board to "fix" the situation, as opposed to the best way for students. It became clear that though the scores could be called "reliable," they would not necessarily be "accurate," especially for certain students. Students began to worry about how the test scores would affect admissions and qualifications for scholarships. Students began demanding anoptional retest for anyone who had been affected by the College Board's error.One student from Long Island has filed a lawsuit against the College Board, saying that scores of a test missing nearly 30% of its content cannot be considered valid. She has demanded unspecified monetary damanges and a re-test for anyone who wanted it. Another student started a change.org petition that quickly attracted over 1,000 supporters demanding another chance to take the test for free. The College Board Listened and Is Now Offering a Retest Late on June 15th, the College Board responded to unhappy students with an offer for a free retest - but maybe not in the way that they were expecting: ââ¬Å"We remain confident in the reliability of scores from the June 6 administration of the SAT and don't want to cause undue anxiety for students by making them believe they need to sit for the test again. However, we have waived the fee for the October SAT administration for students who let us know that their testing experience was negatively affected by the printing error and we will continue to do so, through the September 3 registration deadline for the October administration.â⬠You can see the full text here. Instead of offering students affected by the June 6th test their own makeup date, the College Board is giving free registration for the October test.This is going to mean that the retest will be too late for many students who need it, and it's only a useful offer for those students who were not relying on getting scores this summer. However, it's questionable how much the College Board really wants students to take advantage of the offer, even if they do have the time to get their scores later! For several days this past week, the informational banner with updated informationwas missing from the College Board web site, which meant that students who wanted more information about the retake would have beenunable to find it unless they had the link already.The College Board has now replaced the banner, but many were frustrated by what seemed to be a deliberate attempt to keep the information quiet. Additionally, on the June 6th FAQ page, the information for a retest is at the bottom, and is not emphasized. Many people would not know to look for the updated information. Fortunately for students (and unfortunately for the College Board), their mistake has received enough national attention that the retest is beingpublicized through various outlets, even though the College Board itself is trying to keep it quiet! I Called the College Board -Here Is How to Get the Retest Once again, there is a lot of misinformation going around abouthow to actually get registered for the retest.This is mostly because the College Board employees seem to know very little about it themselves. I called the College Board to nail down the information so that you don't have to. The first attempt... The first time I called them, the customer service rep I spoke to had no idea what I was talking about when I asked the process to be signed up for the retest. She insisted several times that there was not going to be a retest for students - this went on for about ten minutes. Finally, I verbally directed her to the appropriate section on their own web site and read it aloud to her. I was then put on hold for several minutes. Another rep picked up. I asked her what the proper procedure was to register for the retest. She told me (in quite an annoyed fashion) that Idid not need to take the retest. She said that theCollege Board was only dropping ONE section of the test, and that the scores would not be affected because they always drop one section as an "experimental section." As you know if you are at all familiar the SAT, there IS always an experimental section, but it is always one of the middle sections of the test - a 25 minute section. I said this to the rep and asked how it would be possible to swap in the experimental section for one of the final sections. Not only are they different lengths, but the whole point of the experimental section is to test out future questions and some of them may not be appropriate. She told me that the experimental section is always randomly selected out of all the sections, which is not true. I also asked how the other section would be accounted for, and was told thatthey are only going to drop one section. Both of these statements are in direct contrast to what has been said to other people who have called, and what has been said by the College Boarditself on its web site. This goes to show how unreliable the information is that they are giving out. If you call and ask for specific information, and it does not seem right to you, make sure to ask to speak to another person. Though we were 20 minutes in and I knew at this point that the conversation was going nowhere, I persevered and asked what I could do to sign up for the retest. I was told that I could wait to see my grades at the end of this month, and if I'm still unhappy to call back by the end of the month to register. The College Board has since updated its statement to specify that they will be accepting registrations through September 3rd for the October 4th test. Nevertheless, if you do want to take this retest, I recommend signing up sooner rather than later - see below for why. The second attempt... I called back a couple days later and had a totally different experience. As soon as I said that I wanted to register for the free re-take, the customer service rep agreed quickly and opened my account. I went though the security questions, she asked for my preferred test center, and waived the fee. In less than 4 minutes, I was signed up for the retest for free. The Takeaway In conclusion, here is how to sign up: The free retest hasnotautomatically been applied to your account. If you register for the test and pay, it will probably be more difficult to get your money back, so just call and register over the phone.Usually there is a fee for registering over the phone, but they are not charging this for June 6th testers. Call the College Board Customer Service line at 1-866-756-7346. Give yourself time to make this phone call. As you can see from my experiences above, how your conversation will go completely depends on which customer service rep you talk to. If the rep tries to give you a hard time about registering, ask to speak to another rep or a supervisor.Stay calm and say that you were affected by the College Board's mistake on the June 6th test, and you would like to take them up on the offer that is posted on the web site. If they still give you trouble, stay polite but firm: "This is not what the College Board is publicly offering. I was promised a free retest and I am calling to register for this. If the process remains difficult, I will contact press members to let them know that the College Board is not honoring its promise." You do not have to take the test at the same center where you took the June 6th SAT.This is great news for people like me who signed up for the June SAT late and had to travel quite far to take it. Usually when the College Board offers a retest it does have to be at the same center, so this is a big bonus. You will have to do all the things you normally do at registration time - including confirming your name, birth date, and high school. If you don't have any trouble with the rep, the whole process should take about 5 minutes. Afterwards, you will receive aconfirmation email and will be able to sign into your account to print out your admissions ticket. Can I See My Scores First? Yes, you can!The scores from the test you took on June 6th will be available around June 25th. You are welcome to look at your scores and decide if you want to take the test again. The College Board has done this intentionally, because they are hoping that many people will be satisfied with their scores and will decide to not take the test again.Remember, for each person who does decide to do the retest, they are losing out on potential registration money. Even if you sign up for the retest now, your scores will still be delivered on time. Remember, however, that these scoreswill not include sections 8 and 9, and youwill not have the option to see what your score would have been with those sections.So it will be difficult todetermine if you have beenpositively or negatively affected by the shorter test. Since they have now officially said that free registration will be available through September 3, you can feel comfortable waiting to sign up if you want to. But it might be a better idea to not wait.Since the College Board is not offering a separate test date for the retest,there will be many more people than usual signing up for the October test.Therefore, there is a very good chance that testing centers will fill up quite quickly. If you register now, you can always cancel later if you want to, and you do not have to risk potential disappointment at not getting a seat. Should I Take the Retest? For most students, signing up for the retest is a good idea if it's at all possible for your schedule. If you get your scores back and think that you were negatively affected, this is the best way to fix it - for free. And if it turns out that you did better than you were expecting to do, you can always cancel your registration. You will not lose out on any money from the registration costs because it's free. If this was your last chance to take the SAT for one deadline or another, then the retest will not really affect you. Though some schools are taking the "wait and see" approach for this test, it is very likely that most willhonor the results, especially for seniors or those who took the June 6th test on a tight deadline. If you feel that you have been significantly disadvantaged by the College Board's error, and cannot take the retest, it might be a good idea to keep an eye on the lawsuit mentioned above to see how it progresses. If they win, you may be entitled to some compensation. Last Words... If you do decide to retake the test, you should use the experience you have had with this test to help guide your studying. Set aside time this summer for dedicated prep so that you can smash it this fall. Whatââ¬â¢s Next? Worried that taking the SAT again this fall will be one time too many? Read our guide on how many times you should take the SAT. To prep for the re-test this fall, read our 11 top, must-read guides to prepare yourself for the next test. Learn our expert strategies to improve your SAT Math, SAT Writing, and SAT Reading scores to help push your scores above 600s in any section. Wanta top score on the re-take? Read our guide to getting a perfect SAT score. Want to improve your SAT score by 160 points?We have the industry's leading SAT prep program. Built by Harvard grads and SAT full scorers, the program learns your strengths and weaknesses through advanced statistics, then customizes your prep program to you so you get the most effective prep possible. Check out our 5-day free trial today:
Monday, March 2, 2020
The Good Times are Killing Me
The Good Times are Killing Me If you are looking for a compelling play for a young mixed-race cast, you may want to take a look at The Good Times are Killing Me by Lynda Barry. This play, published in 1993, offers two strong female roles in which teenagers can play teenagersà and a multiplicity of issues to discuss with cast and crew during rehearsals and with audiences in talkbacks. Format This is a two-act play, but it is unusual in that it is comprised of 36 short scenes or vignettes- 26 in Act One and 10 in Act 2. The story is adolescent Edna Arkinsââ¬â¢s story. She is the main character and she appears in every scene; she breaks the fourth wall and speaks to the audience before, during, and after interacting with the other characters. Each vignette has a title like RECORD PLAYER NIGHT CLUB or BEST FRIENDS that communicates the essence of the scene. The scenes- some only a half page long, some three pages long- reveal the story of friendship between two adolescent girls- one white and one black- in mid-1960s America. One vignette flows into the next creating a collection of scenes that reveal the difficulties of coming of age in the midst of family heartaches, personal growing pains, and racial prejudices. Cast Size There are roles for 16 females and 8 males. Broken down by race, the play calls for 10 white females and 6 black females, and 3 white males and 5 black males. Doubling in roles is possible, resulting in an overall minimal cast size of 16. Roles Edna Arkins: A white 12-13 year-old girl who lives with her family in a house on a city street that has slowly become integrated Lucy Arkins: Ednaââ¬â¢s younger sister Ednaââ¬â¢s Parents and Extended Family: Mom, Dad, Uncle Don, Aunt Margaret, Cousin Steve, and Cousin Ellen Bonna Willis: A black 12-13 year-old girl who recently moved into Ednaââ¬â¢s neighborhood Bonnaââ¬â¢s Parents and Extended Family: Mom, Dad, younger brother Elvin, and Aunt Martha Recurring Minor Roles: Two black teenagers named Earl and Bonita, and Cousin Ellenââ¬â¢s friend Sharon Ensemble: There are multiple scenes that would be enhanced by friends, neighbors, classmates, and other people. There are also several small roles- a teacher, a mother, a pastor, a Girl Scout leader and her daughter. Set and Costumes Most action occurs on the porches, street, yards, and kitchens of Ednaââ¬â¢s and Bonitaââ¬â¢s houses. Other settings are Ednaââ¬â¢s basement, a campsite, a meeting room, a tough neighborhood, a church, and a school hallway. These can easily be suggested with lighting or a few moveable small set pieces. The time period of this play is critical to the story, so the costumes need to be early 1960s American clothing- mostly casual and inexpensive-looking. Music Songs and singing occur throughout this production, providing mood, underscoring emotions and actions, and contextualizing the story in 1960s urban America. Much of the singing occurs with the records that the characters play; some singing is a capella. The script identifies the precise songs and provides lyrics within the text or in an appendix. Content Issues Much of the content and language of this play seems so innocent given the 20-plus years since its opening night and its setting of 50-plus years ago. Even so, itââ¬â¢s worth noting that the play deals with marital infidelity, racial discrimination (One of Ednaââ¬â¢s lines mentions the ââ¬Å"No Negro Kids Can Come in Our House Rule.), and the accidental drowning of Bonnaââ¬â¢s brother. The language is relatively tame, but the dialogue does include the words à ââ¬Å"ass,â⬠ââ¬Å"boodie,â⬠ââ¬Å"pimp,â⬠ââ¬Å"butt,â⬠and the like. There is, however, no profanity. Lynda Barry also published this story as a 144-page novel with Edna as the narrator. If you would like to hear Lynda Barry talk about her life work, please visit Accessing the Imaginary. Here is a video trailer of a high school production of the play.
Friday, February 14, 2020
Importance of Maps to GIScience Essay Example | Topics and Well Written Essays - 1500 words
Importance of Maps to GIScience - Essay Example Goodchildà introduced the termà GIScienceà in the year 1992 to describe the basics ofà GISà technology.à à These discussions dealt with the scope of a new branch ofà GISà and the obstacles in the way of its application of the technology.à GISà is defined as the Science dealing with the interpretation and management of spatial information in scientific context, including associated technology, and implications of these for Commerce, Social life and the environment.à à à Information Analysis and interpretation of Data and transforming these into visual representations constitute among other things the Information Management function. Hardware and software that facilitate this process come under the category of associated methodology. Geographical Information and the GI system have tremendous applications to commerce and environment and naturally they will impact the society as a consequence.à GISà now facilitates production of all kinds of Maps which ser ve as stimulants to visualized thinking. GI System therefore admirably fits in as Research on GI Science. Experts addressed the problem of developing visualization methods and techniques to present GI data interpret and synthesize them and explore them further, (MacEachren, 1995). This goes on further to assess the impact of these on the efficiency of problem solving. They further described the processes by which maps and graphics could be generated and the Computations systems to back these operations. The inter-connections between maps andà GIScienceà and its associated steps in the process and the possible outputs also engaged many research works. Maps have the power to visually represent data, synthesize these and then explore the world. This is possible because of the ability to take selected data from the complex maze of facts and make visual presentation. The Discipline of Cartography has evolved a wide range of design guidelines which help in creating a map that best rep resents the desired results in terms of spatial patterns and inter-relationships. The traditional maps have helped in their own way in the above functions of map making. Yet, the advances made byà GISà have revolutionized the way spatial information is synthesized, analyzed and explored. The numerous maps that needed to be made in the past for presenting different aspects of data pertaining to the same spatial area can now be overlaid on the same spatial outlay and interpreted. The paper will also study the advances made in the versatility of the map making process today, after the development of the Internet and the World Wide Web. Also, while recognizing the traditional role of maps in representation of data it must be pointed out that the maps should go further to be flexible andà à facilitate exploration of the data underlying the maps. Therefore, in view of their ability to visualize the data and stimulate thinking about theà geo-spatialà patterns, maps are extensiv ely used in the GI Science process. The field of operation for these maps is Geo-visualization. It is a loosely defined domain and it addresses the presentation, analysis and synthesis of geographical information in combination with other disciplines including Cartography. Scientific visualization, image analysis, information visualization and analysis of exploratory data are the other disciplines contributing to the advancement. 1.1 Developments of Maps With reference to the design of maps, self-made professional maps, particularly Paper Made Topographic Maps are the work of professionals and are very practical under various conditions. Such maps will still be continued to be produced in the future, even though the demand from the users is already exerting pressure on large Map Maker organizations to adopt a different modern outlook towards the market. There
Sunday, February 2, 2020
Aramex Distribution Strategy Essay Example | Topics and Well Written Essays - 250 words
Aramex Distribution Strategy - Essay Example There are two major factors that make the degree of market exposure required by Aramex very high. The first of these has to do with the fact that the company operates in a modern globalised market where there is so much competition within the logistics and transportation sectors3. Again, there exist limited users of the services that the company offers. Consequently, the company has positioned itself in a manner that ensures that it exposes itself to as many clients as possible. The strategy behind the market exposure has been one that targets globally recognized exporters and their affiliates4. With such as selective distribution strategy, the companyââ¬â¢s investments on marketing always get to the right target and thus bring about the needed returns. Aramex practices a comprehensive distribution channel with so much emphasis on reaching the right people. The main guiding principle to the channel is the fact that the company revolves the distribution channel on an online system whereby distributors, wholesalers, retailers and direct end-users are reached through an online mechanism. Commonly, the over 700 wholesalers of the company get their supplies by placing an electronic demand and they in turn give out their distributions to retailers via electronic commerce5. In the midst of all these, there are terrestrial transporters who operate distribution vans and work directly under the retailers. Invariably therefore, the whole channel becomes a well coordinated one that fits into an integrated marketing channel to form a common
Friday, January 24, 2020
The Origins Of The Church Of Scientology Essay -- Religion Scientology
During the dawn of the mid 20th century a new idea began to formulate within the mind of L. Ron Hubbard that would later give birth to what is known today as one of the fastest growing religions of the 21st century; this controversial religion is called Scientology. Scientology has acquired many individuals from all walks of life, ethnicities, and International regions of the world into its membership. According to the New Oxford American Dictionary the definition of Scientology is ââ¬Å"a religious system based on the seeking of self-knowledge and spiritual fulfillment through graded courses of study and training.â⬠In addition, Scientology claims to comprise the remedies used to deliver people from drugs and alcohol abuse, as well as, therapeutic solutions to help others recover from serious injuries at an astonishing progressive rate. In essence, this movementââ¬â¢s main agenda is to bring order to a world of chaos through spreading its teachings, improving environmental conditions on planet earth, and developing the holistic being through using different methodologies and technologies. Moreover, by obtaining a basic understanding of Scientology and its purpose we can now explore and uncover the answer to a question that sparks the curiosity of outsiders in western civilization; such a question is How did it Begin? The origins of this culture began in the year of 1923 when L. Ron Hubbard started his studies of the mind and spirit. Likewise, such studies resulted in the creation of a manuscript entitled Excalibur; this book was completed in 1938 but was never published. Furthermore, it was in this unpublished work that the word ââ¬Å"Scientologyâ⬠first appeared. The literal interpretation of the phrase means ââ¬Å"the study of knowing how t... ...sion, my answer to the ââ¬Å"churchâ⬠of Scientology pertaining to the existence of God will be in the form of a philosophical question that states, if a tree falls in the forest and no one is around to hear it does it make a sound? Works Cited 1) Cooper, Paulette ââ¬Å"The High Cost Of Scientology.â⬠The Scandal Of Scientology. Web. 28th Nov. 1997 2) Communication Office Bulletin (HCOB). Hubbard, L. Ron. 18 July 1959. 3) ââ¬Å"Dianetics.â⬠New Oxford American Dictionary. Version 2.0.3 2005-2007. 4) lronhubbard.org/biography. N.P., 1995-2010. Web. 6 Nov. 2010 5) patheos.com. N.p., 1 Jan. 2008. Web. 6 Nov. 2010 6) ââ¬Å"Scientology.â⬠New Oxford American Dictionary. Version 2.0.3 2005-2007. 7) The New King James Version (NKJV) Bible. Ed. Thomas Nelson Nashville: 1982. 8) Watchman Fellowship. ââ¬Å"What Christians Should Know about the Church of Scientology.â⬠Web. 1 Jan. 2009.
Thursday, January 16, 2020
Background Screening and the Fair Credit Reporting Act
Recent incidents with domestic and international significance have compelled employers to give more weight and attention to the practice of conducting background checks not only on job applicants but on their current employees as well. Some of these events prodded employers to resort to background screening on their own initiatives while others had been the subject of state and federal requirements. One of the most noteworthy events were the 9/11 terrorist attacks which have made employers more security conscious, leading them to subject the backgrounds of both their prospective and present workers to more rigorous examination.A recorded increase in lawsuits filed against employers involving all sorts of negligence in the hiring of employees, on the other hand, caused employers to stop hiring applicants based solely on their instincts about human nature. Corporate frauds and scandals similar to the Enron case of 2002 had also impelled employers to scrutinize both the private and prof essional lives of the members of their upper management teams such as ââ¬Å"corporate executives, officers, and directorsâ⬠in efforts aimed at preventing financial losses.Newspaper reports claiming that as high as 40% of job applicants in the country have been submitting fabricated resumes and false information have similarly alerted employers into ascertaining the backgrounds of people approaching them for employment (Privacy Rights Clearinghouse). A heightened interest on background checking also resulted from the observed rise in cases involving abductions and abuse of children, older people, and persons with disabilities.This resulted to majority of the states requiring employers to conduct ââ¬Å"criminal background checks for anyone who works with children, the elderly, or disabled. â⬠In fact the database of the National Crime Information Center (NCIC) of the Federal Bureau of Investigation is now accessible to state officials under the authority of the National C hild Protection Act primarily for this purpose (Privacy Rights Clearinghouse). Employers conduct background checks under the authority of the ââ¬Å"Fair Credit Reporting Act (FCRA),â⬠a federal law.Although background checks are not a requirement under the FCRA, employers nevertheless do so in order to comply with the standards set by the national government concerning screening of employees. These national standards are established by the FCRA. Under the FCRA, external organizations should undertake the investigation into the backgrounds of applicants or employees and include the same in a ââ¬Å"consumer report. â⬠Employers are not allowed to apply the provisions of the FCRA to checks which they themselves have done (Privacy Rights Clearinghouse).Examples of information and/or records that could be obtained or accessed through a background check are: ââ¬Å"criminal convictions, driving records, social security number, property ownership, past employees, vehicle regist ration, character references, personal references, credit records, court records, neighbor interviews, state licensing records, incarceration records, workersââ¬â¢ compensation, drug test records, sex offender lists, educational records, military service records, dental records, and bankruptcies within the preceding ten years.â⬠The following information could likewise be available to a check conducted under the FCRA as long as the investigation should cover only the preceding seven years: ââ¬Å"civil suits, civil judgments, paid tax liens, and accounts placed for collectionâ⬠(Privacy Rights Clearinghouse). Under the provisions of the FCRA, before an employer could have a background check conducted, the written consent of the applicant should first be obtained.If after reading the report the employer decides to take an ââ¬Å"adverse actionâ⬠i. e. he/she decides not to hire the applicant, terminate an employee, rescind an offer of a job, or refuse to promote an employee, he/she is required to provide the applicant or employee with a notice or a ââ¬Å"pre-adverse action disclosureâ⬠together with a copy of the result of the background check.After undertaking the ââ¬Å"adverse action,â⬠the name and address of the screening entity should be provided to the applicant or employee in an ââ¬Å"adverse action noticeâ⬠together with an advice that he/she ââ¬Å"has the right to dispute the accuracy or completeness of any of the information in the reportâ⬠(Privacy Rights Clearinghouse). Reference Privacy Rights Clearinghouse. Employment Background Checks: A Jobseekerââ¬â¢s Guide. July 2007. 23 September 2007
Wednesday, January 8, 2020
Thoreau Civil Disobedience Analysis - 963 Words
Overall, Antigoneââ¬â¢s choices fit into Thoreauââ¬â¢s philosophy regarding civil disobedience. In Thoreaus work, ââ¬Å"Civil Disobedience,â⬠Thoreau makes points that clearly justify Antigoneââ¬â¢s actions. One such case is when Antigone goes to give her brother a proper burial. Another one of these cases occurs when Antigone is put into jail for being honorable. Finally, an example of Thoreauââ¬â¢s idea of civil disobedience is epitomized when Antigone refuses allegiance to a government that she views as unjust. According to Thoreau, Antigoneââ¬â¢s actions were just when she went to bury her brother despite Creon decreeing that no can do so. By burying her brother, she refuses to obey an unjust law. Antigoneââ¬â¢s entrapment in the tomb fits into Thoreauââ¬â¢sâ⬠¦show more contentâ⬠¦Antigone does just this by giving her brother a burial because she refuses to follow a law that violates her religion and moral code. As said in ââ¬Å"Antigone: Rebel With a Conscienceâ⬠by Taki Theodoracopulos, ââ¬Å"Antigone was a rebel, someone willing to take a stand against laws they cannot accept.â⬠This supports the fact that Antigone was standing up to a law, that her brother cannot be buried because it violated her moral code, and she was unable to accept breaking her moral code even if she was legally obliged to do so. Antigoneââ¬â¢s actions were also supported by Thoreau when she was jailed and put to death for burying her brother. After learning of Antigoneââ¬â¢s transgression and being asked by Choragos if he is willing to take Antigone from his son, Creon responds, ââ¬Å"No; Death will do that for meâ⬠(Sophocles 214). In doing so, Creon sentences Antigone for imprisonment and eventual death for the crime of giving her brother a proper burial. In ââ¬Å"Civil Disobedience,â⬠Thoreau says, ââ¬Å"Under a government which imprisons unjustly, the true place for a just man is also a prison.â⬠When Thore au says this, he means that because of unjust laws, all those people who are just belong in prison because their just actions are transgressions in the eyes of an unjust government. In ââ¬Å"Antigone: Rebel With a Conscience,â⬠Theodoracopulos claims, ââ¬Å"[Antigone] defies the state and gives [Creon] a token burialâ⬠(Theodoracopulos 1). This claim supports that Antigoneââ¬â¢sShow MoreRelatedThoreau Civil Disobedience Analysis812 Words à |à 4 PagesHenry David Thoreauââ¬â¢s ââ¬Å"Civil Disobedienceâ⬠and Martin Luther Kingââ¬â¢s ââ¬Å"Letter from Birmingham Jailâ⬠both present similar ideas, as the latter was inspired by the first. This set of principles and ideas is still in being carried out in our nation today, however it is necessary for more people to adopt this way of thinking. Thoreau explains throughout how an individual must conduct civil disobedience to begin a change that is morally correct. He talks a lot about the government and heavily criticizesRead MoreThoreau On The Duty Of Civil Disobedience Rhetorical Analysis1250 Words à |à 5 PagesThroughout the duration of the Mexican American war, beginning in 1846, many attempts were made to gather support for the conflict. One citizen, who resided in Connecticut, showed much more drastic distest to this war than many others. Henry David Thoreau took both passive and active efforts to voice his antagonism to the conflict by refusing to pay a tax that he believed supported the ideology behind the war that the United States was partaking in at the time. Later, he contrived an essay that outlinedRead MoreAnalysis Of Civil Disobedience By Henry David Thoreau1886 Words à |à 8 PagesAfrican slave trade that culminated in the American Civil War, the loss of one of the greatest presidents in U.S. history, Ab raham Lincoln, and, more fittingly for this paper, the emergence of American transcendentalist writers. One writer in particular was Henry David Thoreau, who many historians consider to be the inventor of nonviolent protest as a means of reforming a government. This concept is explained in detail in his piece, Civil Disobedience, where he excellently argues that governments areRead MoreAnalysis Of Civil Disobedience, By Henry David Thoreau713 Words à |à 3 PagesHenry David Thoreau, author of ââ¬Å"Civil Disobedienceâ⬠and Walden, has become one of the most influential authors of all time in the eyes of many. Though some might be led to believe his essays and writings, including ââ¬Å"Where I Lived, and What I lived Forâ⬠, make him a down to earth and even rugged author, as he spent some of his life in the forest. However, his life in the woods was not one of heavy duty work and he often was supported with objects and material possessions, contrary to what many of hisR ead MoreAnalysis Of The Poem Civil Disobedience By Henry David Thoreau1219 Words à |à 5 Pagesignorant to the problems others faced. In the essay ââ¬Å"Civil Disobedienceâ⬠by Henry David Thoreau, Thoreau spent a night in jail for refusing to pay his taxes. After his night in jail, the author has a perspective change about the people around him (his ââ¬Å"neighborsâ⬠) and the state. Before he went to jail he thought of his neighbors as friends who were civil when it did not cost them anything and he believed they shared common beliefs. But after Thoreau was imprisoned he says ââ¬Å"that they did not greatlyRead MoreHenry David Thoreau Resistance To Civil Disobedience Analysis1508 Words à |à 7 PagesDuring the era of the civil disobedience, individuals took stand and fight for their rights. the government took actions that violated the rights of others or took restrictions that angered residence. Resistance to civil government by Henry David Thoreau is an essay w ritten about his opinion on opposing the government that was taking control of peopleââ¬â¢s rights, motivating his disagreement of slavery and the Mexican-American war. Mahatma Gandhi, a leader who fought for the Indians independent movementRead MoreLessons in Civil Disobedience828 Words à |à 4 Pagesto its effectiveness, individualism, and past history of the world that has made immense progress. It is important to notice that if civil disobedience was not effective, then it would not be continually used to disobey the law. In The Role of Civil Disobedience in Democracyâ⬠by Kayla Starr, she explains why we have the right to participate in civil disobedience. ââ¬Å"The U.S. Bill of Rights asserts that the authority of a government is derived from the consent of the governed, and whenever any formRead MoreHenry David Thoreau s Civil Disobedience1013 Words à |à 5 PagesIn Henry David Thoreauââ¬â¢s ââ¬Å"Civil Disobedienceâ⬠, Thoreau makes the claim that the best form of government is a government that doesnââ¬â¢t govern at all. Thoreauââ¬â¢s paper pushes for the people to begin following the will of their conscience rather than blindly and foolishly follow the unjust idea of ââ¬Å"majority ruleâ⬠. Throughout the paper Thoreau makes a point of stating that ââ¬Å"majority ruleâ⬠is simply the will of the upper-class being forced into action o ver the rights and wills of the poorer minority. ThisRead MoreThe Effect Of Transcendentalism : Henry David Thoreau1654 Words à |à 7 PagesThe Effect of Transcendentalism: Henry David Thoreau Transcendentalism is the American literary, political, and philosophical movement of the early nineteenth century that was rooted in the pure Romanticism of the English and the German (Goodman). Ralph Waldo Emerson is considered the father of Transcendentalism because his literature is the first to praise the notable spirituality of nature. The basic belief of the movement is to live authentically; being true to oneself (Day). The movement itselfRead MoreCritical Analysis Of Henry David Thoreaus Civil Disobedience984 Words à |à 4 PagesHenry David Thoreau (1817ââ¬â1862) was an introspective who desired only a simple life and wandered the woods of Concord, Massachusetts journaling. How, then, did he influence such political icons as Mohandas Gandhi, Leo Tolstoy, and Martin Luther King Jr.? The answer lies in ââ¬Å"Civil Disobedienceâ⬠(1849). ââ¬Å"Civil Disobedienceâ⬠is an analysis of the individualââ¬â¢s relationship to the state and focuses mainly on why men obey laws even when they violate their own conscience. It is not an essay of abstract
Tuesday, December 31, 2019
Endosymbiotic Theory
The endosymbiotic theory is the accepted mechanism for how eukaryotic cells evolved from prokaryotic cells. First published by Lynn Margulis in the late 1960s, the Endosymbiont Theory proposed that the main organelles of the eukaryotic cell were actually primitive prokaryotic cells that had been engulfed by a different, bigger prokaryotic cell. The term endosymbiosis means to cooperate inside. Whether the larger cell provided protection for the smaller cells, or the smaller cells provided energy to the larger cell, this arrangement seemed to be mutually beneficial to all of the prokaryotes. While this sounded like a far-fetched idea at first, the data to back it up is undeniable. The organelles that seemed to have been their own cells include the mitochondria and, in photosynthetic cells, the chloroplast. Both of these organelles have their own DNA and their own ribosomes that do not match the rest of the cell. This indicates that they could survive and reproduce on their own. In fact, the DNA in the chloroplast is very similar to photosynthetic bacteria called cyanobacteria. The DNA in the mitochondria is most like that of the bacteria that causes typhus. Before these prokaryotes were able to undergo endosymbiosis, they first most likely had to become colonial organisms. Colonial organisms are groups of prokaryotic, single-celled organisms that live in close proximity to other single-celled prokaryotes. Even though the individual single-celled organisms remained separate and could survive independently, there was some sort of advantage to living close to other prokaryotes. Whether this was a function of protection or a way to get more energy, colonialism has to be beneficial in some manner for all of the prokaryotes involved in the colony. Once these single-celled living things were within close enough proximity to one another, they took their symbiotic relationship one step further. The larger unicellular organism engulfed other, smaller, single-celled organisms. At that point, they were no longer independent colonial organisms but instead were one large cell. When the larger cell that had engulfed the smaller cells went to divide, copies of the smaller prokaryotes inside were made and passed down to the daughter cells. Eventually, the smaller prokaryotes that had been engulfed adapted and evolved into some of the organelles we know of today in eukaryotic cells like the mitochondria and chloroplasts. Other organelles eventually arose from these first organelles, including the nucleus where the DNA in a eukaryote is housed, the endoplasmic reticulum and the Golgi Apparatus. In the modern eukaryotic cell, these parts are known as membrane-bound organelles. They still do not appear in prokaryotic cells like bacteria and archaea but are present in all organisms classified under the Eukarya domain.
Monday, December 23, 2019
Poverty and the American Dream Essay - 2446 Words
Poverty and the American Dream Research Paper Final Draft Jeffery White English 101 Section 7 December 20,2012 The American Dream has driven many people for a long time. The dream has been presented in Hollywood movies showing a family or person striving to succeed in America. When the dream is mentioned it is done so as a powerful symbol inspiring a whole nation of immigrants. However, the ââ¬Å"Dreamâ⬠is misleading because it implies there is only one rather than many. Moreover, there are many perceptions of the American Dream and its fulfillment depends on culture, age and citizenship. This misperception of the American Dream has led to the downfall of many immigrants who came in search or pursuit of the American dream. For exampleâ⬠¦show more contentâ⬠¦They show that you can come to America and achieve greatness by doing a little. They have to wear designer clothes and in a suburban home. This view is sometimes defined as: ââ¬Å"A delusion, an illusion meant to keep people dissatisfied and hungering to spend more money, in the hopes that the next purchase will be the one that buys them the happiness they are promised. What no one told our framers is that happiness isnt a commodity. It is something that is internal, easily found, and free of charge. Happiness and the reality of the American dream are found in abandoning the false dream, and creating one of your own. Understanding that all the trappings of Western culture are props in a badly acted movie, and that you can throw their script away and make one of your own is a liberating experience. It is possible to have a wonderfully rich and fulfilling life without designer clothes, a wedding register, minivan, suburban house, or even a TV (Johnson, 2001).â⬠This delusion does not only prevent you from societies true identity, but leads to the downfall of a person. ââ¬Å"For an immigrant the American dream is to achieve economic wellbeing and good quality of life through hard work and perseverance. As well as, the aspect of family and emotional and physical wellbeing.â⬠(Van de Rijt, 2008). Even though this is the view of many immigrants, they are hindered to achieve that success. One has to ask themselves this question: How can immigrantsShow MoreRelatedPoverty And The American Dream919 Words à |à 4 PagesIn 2000, the poverty rate among children was 16.2% (Reef 253)! Poverty is a relevant issue that isn t going away. It s ruining minds and lives at the same time. Poverty changes how people view the American Dream, achieve the American Dream, and even affect how people s brains work and develop. With all of the media s hatred of poor people, it must affect their self-confidence and how they view the American Dream. Through her experience, Jennifer Mayer has noticed that very problem. While workingRead MorePoverty And The American Dream933 Words à |à 4 Pages42% of kids born in poverty will not get out. Today, more Americans are falling below the poverty line and are struggling trying to find a way to get out. The Inequality gap in America has increased for the past few decades. Resulting from Economic Inequality in America, 400 Americans share more than 50% of Americaââ¬â¢s total wealth. These 400 Americans are the Top 1%. While the Top 1% are living luxurious lives, the Bottom 99% is struggling to make ends meet. Inequality is nothing new to the UnitedRead MorePoverty and the American Dream4620 Words à |à 19 Pagesââ¬Å"The American Dreamâ⬠as defined by James Truslow Adams in 1931 is a national ethos of the United States in which freedom includes the opportu nity for prosperity and success, and an upward social mobility achieved through hard work. Truslow states life should be worse and poorer and fuller for everyone, with opportunity for each according to ability or achievement regardless of social class or circumstances of birth. The idea of the American Dream is rooted in the United States Declaration of IndependenceRead MorePoverty And Chances Of Accomplishing The American Dream Essay1239 Words à |à 5 PagesLewis Teofil Husar ENG-111 11/30/16 Poverty and Chances of Accomplishing the American Dream. Everyone has heard of the American dream but is it even achievable? As the years go on, many children are born into poverty and stuck with the possibility of not making it out of the lower class. ââ¬Å"The nations official poverty rate in 2015 was 13.5 percent, with 43.1 million people in poverty, 3.5 million fewer than in 2014. The 1.2 percentage point decrease in the poverty rate from 2014 to 2015 representsRead MoreWage Crisis By Michael Maher : Money, Power And The American Dream : Why Poverty?1189 Words à |à 5 Pageswhen the future actually comes. The films Wage Crisis by Michael Maher; Park Avenue: Money, Power and the American Dream: Why Poverty? by Alex Gibney; and The Secret of Oz by Ben Still, are some of the films that highlight the future or work and the how the wages and economy are really affecting those who are looking for work and trying to work towards a common goal ââ¬â achieving the American Dream. Throughout this review, these movies will be compared to t he content that have been covered in the FutureRead MoreEssay on Poverty and Sociology1344 Words à |à 6 Pages2 million people were considered poor. The nationââ¬â¢s poverty rate rose to 15.1 percent, whereas in 2009, 14.3 percent of people in America were living in poverty (Censky, 2011). That is an increase of 2.6 million people in 2010. In the United States, the federal poverty line ââ¬â an absolute measure of annual income ââ¬â is frequently used to determine who is categorized as poor (Ferris Stein, 2008, 2010). Currently the government defines the poverty line as an income of $11,139 for an individual and $22Read MoreThe American Dream : The Myth Of The American Dream1296 Words à |à 6 PagesThe Myth of The American Dream à à à à à à Over the years immigrants have come to America in hopes of achieving their dreams and finding success. But is America really what itââ¬â¢s thought to be? Can their American à dream become a reality? à Everyone in America has the dream of achieving success and wealth through their own hard work and determination. But due to the vicious cycle of poverty most are unable to achieve their American Dream. à The cycle of poverty in America is affected by many factors includingRead MoreEssay on How Debt Affects Americans822 Words à |à 4 Pagesstruck by debt, they might have trouble recovering. Debt can cause Americans to lose their homes and stability they need to feed, and shelter their families. Although debt comes upon us Americans quickly, people can see debt as terrible thing to be stuck with. It has many disadvantages that can devastate to people. Within debt there are subtopics that can be debated. We have the poor and the people who are living in poverty. Poverty is seen as a big problem within America. ââ¬Å"It is defined as the stateRead MoreThe Poverty Of The United States1486 Words à |à 6 Pageslegally and socially poor in the United States tend to stay in a cycle through life, not always by choice, but because they are given less opportunities, education and tools to achieve their success. The poverty stricken class has a significantly larger income gap than the upper class, the American Dream is weakened through opportunity and is shown through statistics. Inequality exists and is high in America due to the amount of income and wealth that is distributed through power. In America the incomeRead MoreThe American Dream : The American Dream1014 Words à |à 5 Pages The American Dream. The American Dream is made up of many different aspects and ideas. Like moving up the social , escaping poverty , freedom ,equality , pursuing our interests and passions , opinions and safety. Most of the dreams are different for an individual depending on their situation. Poverty is a struggle in life. Not having enough to eat , not having heat and shelter. For the kids , life in poverty is much tougher to overcome than those who already have help with wealth.
Sunday, December 15, 2019
Bioinformatics Free Essays
Full report on BIOINFORMATICS PURIFICACION, MARYNOLD V. CHEM 161. 1 3L 2nd Semester AY 2012-1013 GROUPMATES: Donato, Lualhati M. We will write a custom essay sample on Bioinformatics or any similar topic only for you Order Now Diaz, Manuelle Marie C. Date Submitted: March 8, 2013 Laboratory Instructor: Ms. Herra Grajo I. INTRODUCTION Bioinformatics is the branch ofà biologicalà science which deals with the study of methods for storing, retrieving and analyzing biological data, such asà nucleic acidà (DNA/RNA) and protein sequence, structure, function,à pathwaysà andà genetic interactions. It is very important since it contains large amount of information regarding biomolecules that a human mind is not able to store and process such data. There are different data bases that can be used like National Center for Biotechnology Information (NCBI), European Molecular Biology Laboratory-European Bioinformatics Institute database (EMBL-EBI), GenBank (US-based), SwissProt/UniProt, DNA Data Bank of Japan (DDBJ), Entrez and PubMed. Basicà Localà Alignmentà Searchà Tool, orà BLAST, is anà algorithmà for associatingà primaryà biological sequence information, like amino-acidà sequences of variousà proteinsà or theà nucleotidesà ofà DNA sequences. A BLAST search allows a researcher to compare a query sequence with a library orà databaseà of sequences, and identify library sequences that resemble the query sequence above a certain threshold. The BLAST program was designed byà Stephen Altschul,à Warren Gish,à Webb Miller,à Eugene Myers, and David J. Lipmanà at theà NIHà and was published in theà Journal of Molecular Biologyà in 1990. On the other hand,ProtParam is a very useful softwarethat can compute various physico-chemical properties from a protein sequence. The parameters that can be computed by ProtParam include the molecular weight, theoretical pI, amino acid composition, atomic composition, extinction coefficient, estimated half-life, instability index, aliphatic index and grand average of hydropathicity (GRAVY). At the end of this exercise, the student should be able to understand the concept and process of bioinformatics; to know the process on how to use computer programs related in biological information; and to apply these programs on different protein sequences and identify different informations using these programs. II. METHODOLOGY The FASTA sequence of the given proteins namely; Myk, Gi, Glean, Astara, Niko, SR, Joma, Melai, Danne, Jay, Annie and Hani were analyzed using BLAST and ProtParam. BLAST showed the protein with that given sequence and its function was researched. ProtParam, on the other hand, showed the amino acid composition of the given protein, its theoretical IpH, estimated molecular weight and other pertinent information. III. RESULTS AND DISCUSSION Bioinformatics is the branch ofà biologicalà science which deals with the study of methods for storing, retrieving and analyzing biological data, such asà nucleic acidà (DNA/RNA) and protein sequence, structure, function,à pathwaysà andà genetic interactions. In this exercise, the computer program called Basic Local Alignment Search Tool (BLAST) was used to identify different protein sequences and determine the function of these proteins. Also, a computer program named ProtParam was used to determine the IpH and estimated molecular weight of the said proteins. Different sequences of proteins were analyzed using these 2 algorithms to study their identities, properties and purposes. Table 1 show the list of the given protein sequences, their identity, their theoretical IpH and estimated molecular weight. The FASTA sequences of the different codes are also shown below. PROTEIN SEQUENCES: Myk qavlslyasgrttgivldsgdgvthtvpiyegfalphailrldlagrdltdalmkiltergysftttaereivrdikeklayvaldyeqelesa Gi mftasqegdgmskshvhrsvwwswlvgvltvvglglglgsgvglapgsaapsglaldrfadrplapidps Glean mmvawwslflyglqvaapalaatpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftaiwitpvtar Astara kkkslalvlatgmavttfggtgsafadsknvlstkkynetvqspefvsgdlteatgkkaesvvfdylnaakgdyklgeksaqdcfkvkqakkdavtdst Niko mgsigaasmefcfdvfkelkvhhanenifycpiaimsalamvylgakdstrtqinkvvrfdklpgfgdsieaqcgtsvnvhsslrdil SR ndfnlqdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdvirrfkaskfgskdgvgtvfdafpdqvaiqlndthpalaipel Joma vgeimnskrdaeavgpeafadedfderevrgigkflhsakkfgkafvgeimnskrdaeavgpeafadedlderevrgigkflhsakkf gk Melai tedskgghpfssetkeklnkeggafpgpsgslkfcpleiaqklwkenhseiypimktptrtrlaliicstdfqhlsrrvgadvdlremklllqdlgytvkvkenltale Danne kllravitcltypekhfekvlrlsinkmgtdewgltrvvttrtevdmerikeeyqrrnsipldraiakdtsgdyedmlvallghgda Jay sltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclyaiydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrr Annie kakyltemprasellshgipykankravpdridwresgyvtevkdqggcgscwafsttgamegqymknektsisfseqqlvdcsgpfgnygcngglmena Hani valkgfakffkessdeerehaeklmeyqnkrggrvrlqsivtpltefdhpekgdalyamelalaleklvneklhnlhgvatrcndpqltdfieseflee Table 1. Identity, IpH and molecular weight of different protein sequences. Name| Identity| IpH| Molecular weight, g/mol| Myk| NBD_sugar-kinase_HSAP70_actin superfamilyActin| 4. 72| 10344. 7| Gi| Pepsin A trypsin| 5. 97| 7144. 1| Glean| AmyAC_family superfamilyAmylase A| 5. 93| 10002. 4| Astara| Protease| 8. 97| 10595. 0| Niko| SERPIN superfamilySerpin ovalbumin| 6. 24| 9899. 4| SR| Glycosyltransferase_GTB_type superfamilyGlycogen phosphorylase| 4. 65| 11336. 7| Joma| Magainin| 5. 21| 9931. 1| Melai| CASc superfamilyCaspase| 7. 73| 12230. 0| Danne| Annexin superfamilyAnnexin| 6. 14| 10022. 5| Jay| ADF_gelsolon superfamilyCofilin| 5. 47| 11504. 0| Annie| Peptidase_C1ACathepsin| 5. 80| 10982. 2| Hani| Euk_FerritinFerritin_like superfamilyFerritin| 5. 06| 11519. 9| Actin formsà microfilamentsà which are typically one of the most dynamic of the three subclasses of the eukaryoticà cytoskeleton. In turn, this gives actin major functions in cells: * To formà microfilamentsà to give mechanical support to cells, and provide trafficking routes through the cytoplasm to support signal transduction. * To allowà cell motilityà in cells which undergoà amoeboidà motion usingà pseudopods andà phagocytosis, for example of bacteria byà macrophages. * Inà metazoanà muscleà cells, to be the scaffold on whichà myosinà proteins generate force to support muscle contraction. In nonmuscle cells, to be a track for cargo transport myosins (nonconventional myosins) such as myosin V and VI. Nonconventional myosins use ATP hydrolysis to transport cargo, such asà vesiclesà and organelles, in a directed fashion much faster than diffusion. Myosin V walks towards the barbed end of actin filaments, while myosin VI walks toward the pointed end. Most actin filaments are arranged with the barbed end toward the cellular membrane and the pointed end toward the cellular interior. This arrangement allows myosin V to be an effective motor for export of cargos, and myosin VI to be an effective motor for import. Pepsinà is anà enzymeà whoseà zymogenà (pepsinogen) is released by theà chief cellsà in theà stomachà and that degrades foodà proteinsà intoà peptides. The ? -amylases (ECà 3. 2. 1. 1à ) (CAS# 9014-71-5) (alternative names: 1,4-? -D-glucan glucanohydrolase; glycogenase)areà calciumà metalloenzymes, completely unable to function in the absence of calcium. By acting at random locations along the starch chain, alpha-amylase breaks down ling-chain carbohydrates, ultimately yielding maltotriose and maltose from amyloase, glucose and ââ¬Å"limit dextrinâ⬠from amylopectin. It can act anywhere on theà substrate, ? amylase tends to be faster-acting than ? -amylase. Inà animals, it is a majorà digestiveà enzyme, and its optimum pH is 6. 7-7. 0. In human physiology, both the salivary and pancreatic amylases are ? -amylases. Aà proteaseà (also termedà peptidaseà orà proteinase) is anyà enzymeà that conductsà proteolysis, that is, beg insà proteinà catabolismà byà hydrolysisà of theà peptide bondsà that linkà amino acidsà together in thepolypeptideà chain forming the protein. Serpinsà are a group ofà proteinsà with similar structures that were first identified as a set of proteins able toà inhibità proteases. Glycogen phosphorylase catalyzes the rate-limiting step inà glycogenolysisà in animals by releasingà glucose-1-phosphateà from the terminal alpha-1,4-glycosidic bond. Ovalbuminà (OVA) is the mainà proteinà found inà egg white, making up 60-65% of the total protein. Ovalbumin displays sequence and three-dimensionalà homologyà to theà serpinà superfamily, but unlike most serpins it is not aà serine proteaseà inhibitor. The function of ovalbumin is unknown, although it is presumed to be aà storage protein. Ovalbumin is an important protein in several different areas of research, including:general studies of protein structure and propertiesbecause it is available in large quantities; studies of serpin structure and function since ovalbumin does not inhibit proteases which means that by comparing its structure with that of inhibitory serpins, the structural characteristics required for inhibition can be determined; in proteomicsà where it is used as a molecular weight marker for calibratingà electrophoresisà gel; and in immunology where it is commonly used to stimulate anà allergic reactionà in test subjects likean established model allergen forà airway hyper-responsiveness, AHR. Caspases, orà cysteine-aspartic orà cysteine-dependentà aspartate-directed proteasesà are a family ofà cysteine proteasesà that play essential roles inapoptosisà (programmed cell death),à necrosis, andà inflammation. Caspase 1/interleukin-1 converting enzyme is anà enzymeà thatà proteolyticallyà cleaves other proteins, such as theà precursorà forms of the inflammatorycytokinesà interleukin 1-? andà interleukin 18, into active mature peptides. It belongs to a family ofà cysteine proteasesà known asà caspasesà that always cleave proteins following anà aspartic acidà residue. Caspase 1 has been shown to induce cellà necrosisà orà pyroptosisà and may function in various developmental stages. Studies of a similar protein in mouse suggest a role in the pathogenesis ofà Huntingtonââ¬â¢s disease. Alternative splicingà of the gene results in five transcript variants encoding distinct isoforms. Annexins have been observed to play a role along theà exocytoticà pathway, specifically in the later stages, near or at the plasma membrane. Annexins have been found to be the later stages, near or at the plasma membrane. Annexins have been found to be involved in the transport and also sorting of endocytotic events. Annexin one is a substrate of the EGF (epidermal growth factor)à tyrosine kinaseà which becomes phosphorylated on its N terminus when the receptor is internalized. Cofilin is a ubiquitous actin-binding factor required for the reorganization of actin filaments. ADF/Cofilin family members bind G-actin monomers and depolymerize actin filaments through two mechanisms: severing and increasing the off-rate for actin monomers from the pointed end. Olderâ⬠ADP/ADP-Pi actin filaments free of tropomyosin and proper pH are required for cofilin to function effectively. In the presence of readily available ATP-G-actin cofilin speeds-up actin polymerization via its actin- severing activity (providing free barbed ends for further polymerization and nucleation by the Arp2/3 complex). As a long-lastingà in vivoà effect, cofilin recycles older ADP-F-actin, helping cell to maintain ATP-G-actin pool for sustained motility. pH, phosphorylation and phosphoinositides regulate cofilinââ¬â¢s binding and associating activity with actin Theà Arp2/3 complexà and cofilin work together to reorganize the actin filaments in theà cytoskeleton. Arp 2/3, an actin binding proteins complex, binds to the side of ATP-F-actin near the growing barbed end of the filament, causing nucleation of a new F-actin branch, while cofilin-driven depolymerization takes place after dissociating from the Arp2/3 complex. They also work together to reorganize microtubules in order to traffic more proteins by vesicle to continue the growth of filaments. Cofilin also binds with other proteins such asà myosin,à tropomyosin,à ? -actinin,à gelsolinà andà scruin. These proteins compete with cofilin for actin binding. ?ofilin also play role in innate immune response. Cathepsins have a vital role in mammalian cellular turnover, e. g. bone resorption. They degradeà polypeptidesà and are distinguished by theirà substrateà specificites. Ferritin serves to store iron in a non-toxic form, to deposit it in a safe form, and to transport it to areas where it is required. Knowing the protein sequence gives many advantages in studies especially dealing with medicine. The protein of interest whether it is the cause of the abnormality or the cure for abnormality can be identified with just few clicks. The reasons behind similarity of protein sequences despite diversity of source organism is because even though all protein families have distinct functional compositions across different species, some conserved functional features among family members included a shared reaction mechanism, cofactor usage, and/or ligand specificity. IV. SUMMARY AND CONCLUSION Bioinformatics is the branch ofà biologicalà science which deals with the study of methods for storing, retrieving and analyzing biological data, such asà nucleic acidà (DNA/RNA) and protein sequence, structure, function,à pathwaysà andà genetic interactions. It is very important since it contains large amount of information regarding biomolecules that a human mind is not able to store and process such data. Basicà Localà Alignmentà Searchà Tool (BLAST), anà algorithmà for associatingà primaryà biological sequence information, like amino-acidà sequences of variousà proteinsà or theà nucleotidesà ofà DNA sequences; and ProtParam, a very useful software that can compute various physico-chemical properties from a protein sequence. Such parameters include the molecular weight, theoretical pI, amino acid composition, atomic composition, extinction coefficient, estimated half-life, instability index, How to cite Bioinformatics, Essay examples Bioinformatics Free Essays Full report on BIOINFORMATICS PURIFICACION, MARYNOLD V. CHEM 161. 1 3L 2nd Semester AY 2012-1013 GROUPMATES: Donato, Lualhati M. We will write a custom essay sample on Bioinformatics or any similar topic only for you Order Now Diaz, Manuelle Marie C. Date Submitted: March 8, 2013 Laboratory Instructor: Ms. Herra Grajo I. INTRODUCTION Bioinformatics is the branch ofà biologicalà science which deals with the study of methods for storing, retrieving and analyzing biological data, such asà nucleic acidà (DNA/RNA) and protein sequence, structure, function,à pathwaysà andà genetic interactions. It is very important since it contains large amount of information regarding biomolecules that a human mind is not able to store and process such data. There are different data bases that can be used like National Center for Biotechnology Information (NCBI), European Molecular Biology Laboratory-European Bioinformatics Institute database (EMBL-EBI), GenBank (US-based), SwissProt/UniProt, DNA Data Bank of Japan (DDBJ), Entrez and PubMed. Basicà Localà Alignmentà Searchà Tool, orà BLAST, is anà algorithmà for associatingà primaryà biological sequence information, like amino-acidà sequences of variousà proteinsà or theà nucleotidesà ofà DNA sequences. A BLAST search allows a researcher to compare a query sequence with a library orà databaseà of sequences, and identify library sequences that resemble the query sequence above a certain threshold. The BLAST program was designed byà Stephen Altschul,à Warren Gish,à Webb Miller,à Eugene Myers, and David J. Lipmanà at theà NIHà and was published in theà Journal of Molecular Biologyà in 1990. On the other hand,ProtParam is a very useful softwarethat can compute various physico-chemical properties from a protein sequence. The parameters that can be computed by ProtParam include the molecular weight, theoretical pI, amino acid composition, atomic composition, extinction coefficient, estimated half-life, instability index, aliphatic index and grand average of hydropathicity (GRAVY). At the end of this exercise, the student should be able to understand the concept and process of bioinformatics; to know the process on how to use computer programs related in biological information; and to apply these programs on different protein sequences and identify different informations using these programs. II. METHODOLOGY The FASTA sequence of the given proteins namely; Myk, Gi, Glean, Astara, Niko, SR, Joma, Melai, Danne, Jay, Annie and Hani were analyzed using BLAST and ProtParam. BLAST showed the protein with that given sequence and its function was researched. ProtParam, on the other hand, showed the amino acid composition of the given protein, its theoretical IpH, estimated molecular weight and other pertinent information. III. RESULTS AND DISCUSSION Bioinformatics is the branch ofà biologicalà science which deals with the study of methods for storing, retrieving and analyzing biological data, such asà nucleic acidà (DNA/RNA) and protein sequence, structure, function,à pathwaysà andà genetic interactions. In this exercise, the computer program called Basic Local Alignment Search Tool (BLAST) was used to identify different protein sequences and determine the function of these proteins. Also, a computer program named ProtParam was used to determine the IpH and estimated molecular weight of the said proteins. Different sequences of proteins were analyzed using these 2 algorithms to study their identities, properties and purposes. Table 1 show the list of the given protein sequences, their identity, their theoretical IpH and estimated molecular weight. The FASTA sequences of the different codes are also shown below. PROTEIN SEQUENCES: Myk qavlslyasgrttgivldsgdgvthtvpiyegfalphailrldlagrdltdalmkiltergysftttaereivrdikeklayvaldyeqelesa Gi mftasqegdgmskshvhrsvwwswlvgvltvvglglglgsgvglapgsaapsglaldrfadrplapidps Glean mmvawwslflyglqvaapalaatpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftaiwitpvtar Astara kkkslalvlatgmavttfggtgsafadsknvlstkkynetvqspefvsgdlteatgkkaesvvfdylnaakgdyklgeksaqdcfkvkqakkdavtdst Niko mgsigaasmefcfdvfkelkvhhanenifycpiaimsalamvylgakdstrtqinkvvrfdklpgfgdsieaqcgtsvnvhsslrdil SR ndfnlqdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdvirrfkaskfgskdgvgtvfdafpdqvaiqlndthpalaipel Joma vgeimnskrdaeavgpeafadedfderevrgigkflhsakkfgkafvgeimnskrdaeavgpeafadedlderevrgigkflhsakkf gk Melai tedskgghpfssetkeklnkeggafpgpsgslkfcpleiaqklwkenhseiypimktptrtrlaliicstdfqhlsrrvgadvdlremklllqdlgytvkvkenltale Danne kllravitcltypekhfekvlrlsinkmgtdewgltrvvttrtevdmerikeeyqrrnsipldraiakdtsgdyedmlvallghgda Jay sltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclyaiydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrr Annie kakyltemprasellshgipykankravpdridwresgyvtevkdqggcgscwafsttgamegqymknektsisfseqqlvdcsgpfgnygcngglmena Hani valkgfakffkessdeerehaeklmeyqnkrggrvrlqsivtpltefdhpekgdalyamelalaleklvneklhnlhgvatrcndpqltdfieseflee Table 1. Identity, IpH and molecular weight of different protein sequences. Name| Identity| IpH| Molecular weight, g/mol| Myk| NBD_sugar-kinase_HSAP70_actin superfamilyActin| 4. 72| 10344. 7| Gi| Pepsin A trypsin| 5. 97| 7144. 1| Glean| AmyAC_family superfamilyAmylase A| 5. 93| 10002. 4| Astara| Protease| 8. 97| 10595. 0| Niko| SERPIN superfamilySerpin ovalbumin| 6. 24| 9899. 4| SR| Glycosyltransferase_GTB_type superfamilyGlycogen phosphorylase| 4. 65| 11336. 7| Joma| Magainin| 5. 21| 9931. 1| Melai| CASc superfamilyCaspase| 7. 73| 12230. 0| Danne| Annexin superfamilyAnnexin| 6. 14| 10022. 5| Jay| ADF_gelsolon superfamilyCofilin| 5. 47| 11504. 0| Annie| Peptidase_C1ACathepsin| 5. 80| 10982. 2| Hani| Euk_FerritinFerritin_like superfamilyFerritin| 5. 06| 11519. 9| Actin formsà microfilamentsà which are typically one of the most dynamic of the three subclasses of the eukaryoticà cytoskeleton. In turn, this gives actin major functions in cells: * To formà microfilamentsà to give mechanical support to cells, and provide trafficking routes through the cytoplasm to support signal transduction. * To allowà cell motilityà in cells which undergoà amoeboidà motion usingà pseudopods andà phagocytosis, for example of bacteria byà macrophages. * Inà metazoanà muscleà cells, to be the scaffold on whichà myosinà proteins generate force to support muscle contraction. In nonmuscle cells, to be a track for cargo transport myosins (nonconventional myosins) such as myosin V and VI. Nonconventional myosins use ATP hydrolysis to transport cargo, such asà vesiclesà and organelles, in a directed fashion much faster than diffusion. Myosin V walks towards the barbed end of actin filaments, while myosin VI walks toward the pointed end. Most actin filaments are arranged with the barbed end toward the cellular membrane and the pointed end toward the cellular interior. This arrangement allows myosin V to be an effective motor for export of cargos, and myosin VI to be an effective motor for import. Pepsinà is anà enzymeà whoseà zymogenà (pepsinogen) is released by theà chief cellsà in theà stomachà and that degrades foodà proteinsà intoà peptides. The ? -amylases (ECà 3. 2. 1. 1à ) (CAS# 9014-71-5) (alternative names: 1,4-? -D-glucan glucanohydrolase; glycogenase)areà calciumà metalloenzymes, completely unable to function in the absence of calcium. By acting at random locations along the starch chain, alpha-amylase breaks down ling-chain carbohydrates, ultimately yielding maltotriose and maltose from amyloase, glucose and ââ¬Å"limit dextrinâ⬠from amylopectin. It can act anywhere on theà substrate, ? amylase tends to be faster-acting than ? -amylase. Inà animals, it is a majorà digestiveà enzyme, and its optimum pH is 6. 7-7. 0. In human physiology, both the salivary and pancreatic amylases are ? -amylases. Aà proteaseà (also termedà peptidaseà orà proteinase) is anyà enzymeà that conductsà proteolysis, that is, beg insà proteinà catabolismà byà hydrolysisà of theà peptide bondsà that linkà amino acidsà together in thepolypeptideà chain forming the protein. Serpinsà are a group ofà proteinsà with similar structures that were first identified as a set of proteins able toà inhibità proteases. Glycogen phosphorylase catalyzes the rate-limiting step inà glycogenolysisà in animals by releasingà glucose-1-phosphateà from the terminal alpha-1,4-glycosidic bond. Ovalbuminà (OVA) is the mainà proteinà found inà egg white, making up 60-65% of the total protein. Ovalbumin displays sequence and three-dimensionalà homologyà to theà serpinà superfamily, but unlike most serpins it is not aà serine proteaseà inhibitor. The function of ovalbumin is unknown, although it is presumed to be aà storage protein. Ovalbumin is an important protein in several different areas of research, including:general studies of protein structure and propertiesbecause it is available in large quantities; studies of serpin structure and function since ovalbumin does not inhibit proteases which means that by comparing its structure with that of inhibitory serpins, the structural characteristics required for inhibition can be determined; in proteomicsà where it is used as a molecular weight marker for calibratingà electrophoresisà gel; and in immunology where it is commonly used to stimulate anà allergic reactionà in test subjects likean established model allergen forà airway hyper-responsiveness, AHR. Caspases, orà cysteine-aspartic orà cysteine-dependentà aspartate-directed proteasesà are a family ofà cysteine proteasesà that play essential roles inapoptosisà (programmed cell death),à necrosis, andà inflammation. Caspase 1/interleukin-1 converting enzyme is anà enzymeà thatà proteolyticallyà cleaves other proteins, such as theà precursorà forms of the inflammatorycytokinesà interleukin 1-? andà interleukin 18, into active mature peptides. It belongs to a family ofà cysteine proteasesà known asà caspasesà that always cleave proteins following anà aspartic acidà residue. Caspase 1 has been shown to induce cellà necrosisà orà pyroptosisà and may function in various developmental stages. Studies of a similar protein in mouse suggest a role in the pathogenesis ofà Huntingtonââ¬â¢s disease. Alternative splicingà of the gene results in five transcript variants encoding distinct isoforms. Annexins have been observed to play a role along theà exocytoticà pathway, specifically in the later stages, near or at the plasma membrane. Annexins have been found to be the later stages, near or at the plasma membrane. Annexins have been found to be involved in the transport and also sorting of endocytotic events. Annexin one is a substrate of the EGF (epidermal growth factor)à tyrosine kinaseà which becomes phosphorylated on its N terminus when the receptor is internalized. Cofilin is a ubiquitous actin-binding factor required for the reorganization of actin filaments. ADF/Cofilin family members bind G-actin monomers and depolymerize actin filaments through two mechanisms: severing and increasing the off-rate for actin monomers from the pointed end. Olderâ⬠ADP/ADP-Pi actin filaments free of tropomyosin and proper pH are required for cofilin to function effectively. In the presence of readily available ATP-G-actin cofilin speeds-up actin polymerization via its actin- severing activity (providing free barbed ends for further polymerization and nucleation by the Arp2/3 complex). As a long-lastingà in vivoà effect, cofilin recycles older ADP-F-actin, helping cell to maintain ATP-G-actin pool for sustained motility. pH, phosphorylation and phosphoinositides regulate cofilinââ¬â¢s binding and associating activity with actin Theà Arp2/3 complexà and cofilin work together to reorganize the actin filaments in theà cytoskeleton. Arp 2/3, an actin binding proteins complex, binds to the side of ATP-F-actin near the growing barbed end of the filament, causing nucleation of a new F-actin branch, while cofilin-driven depolymerization takes place after dissociating from the Arp2/3 complex. They also work together to reorganize microtubules in order to traffic more proteins by vesicle to continue the growth of filaments. Cofilin also binds with other proteins such asà myosin,à tropomyosin,à ? -actinin,à gelsolinà andà scruin. These proteins compete with cofilin for actin binding. ?ofilin also play role in innate immune response. Cathepsins have a vital role in mammalian cellular turnover, e. g. bone resorption. They degradeà polypeptidesà and are distinguished by theirà substrateà specificites. Ferritin serves to store iron in a non-toxic form, to deposit it in a safe form, and to transport it to areas where it is required. Knowing the protein sequence gives many advantages in studies especially dealing with medicine. The protein of interest whether it is the cause of the abnormality or the cure for abnormality can be identified with just few clicks. The reasons behind similarity of protein sequences despite diversity of source organism is because even though all protein families have distinct functional compositions across different species, some conserved functional features among family members included a shared reaction mechanism, cofactor usage, and/or ligand specificity. IV. SUMMARY AND CONCLUSION Bioinformatics is the branch ofà biologicalà science which deals with the study of methods for storing, retrieving and analyzing biological data, such asà nucleic acidà (DNA/RNA) and protein sequence, structure, function,à pathwaysà andà genetic interactions. It is very important since it contains large amount of information regarding biomolecules that a human mind is not able to store and process such data. Basicà Localà Alignmentà Searchà Tool (BLAST), anà algorithmà for associatingà primaryà biological sequence information, like amino-acidà sequences of variousà proteinsà or theà nucleotidesà ofà DNA sequences; and ProtParam, a very useful software that can compute various physico-chemical properties from a protein sequence. Such parameters include the molecular weight, theoretical pI, amino acid composition, atomic composition, extinction coefficient, estimated half-life, instability index, How to cite Bioinformatics, Papers Bioinformatics Free Essays As the world has changed into computer based and more of technology based, so has the various fields changed. Molecular biology is concerned with how the systems of a cell interact which also includes the DNA and RNA interactions plus the protein biosynthesis. It therefore involves several techniques which include Polymerase Chain Reactions, Western Blotting, southern blotting, expression cloning, gel electrophoresis and so many other techniques. We will write a custom essay sample on Bioinformatics or any similar topic only for you Order Now Since it is mostly involved in the interactions of the cell systems, it requires means to be able to identify the DNA which are similar, if the DNA of some organism are evolving, if some mutation in a DNA can help in new inventions about how to deal with certain problems of the world among others. Determination of all these requires the use of information technology. There have been major advances in molecular biology and advances in technologies of genomic study too. This is the reason why there has been growth in biological information created by the scientists (Gibas and Jambeck, 2001). Because of these advances, genomic information has to be computerized and stored in databases in an organized manner for use. The databases are organized in a manner that scientists can retrieve information about a genome and more, add more information if need be and for future references (Gibas and Jambeck, 2001). It therefore means that the databases index the data for viewing and analysis purposes. Application of information technology in the field of molecular biology is what is known as Bioinformatics. It involves the creation of algorithms statistical techniques, databases and computational techniques in molecular biology. There are theories on how the biological data should be solved and how they should be managed. These are the theories that are the base of computation, data storage, data analysis and formation of algorithms (Letovsky, 1999). Bioinformatics This is a field of science, created due to the changing world enabling advances in molecular biology, that merge molecular biology, information technology and computer science together (Baxevanis and Ouellette, 2001). It is therefore a single discipline meant to make possible biological insight discoveries. It also creates an international perspective of biological principles discernation (Letovsky, 1999). As has been noted, this field was created due to the advances in molecular biology. At the beginning, as the world of computer began to take over, Bioinformatics was just meant for biological information storage. It was as simple as creation of the databases and maintaining them. Information stored at that time was amino acid sequences and nucleotide sequences. At this time though, the researchers could retrieve information and put in more either revised or new invention (Baxevanis and Ouellette, 2001). As time and more advances are being made and more information is needed about the interaction of the cell system, Bioinformatics is evolving too. It is getting more complex with more information and more activities on molecular biology. This is due to the need to comprehend the normal cellular activities so that any abnormalities can be easily detected. Bioinformatics currently provides options of analysis and interpretation of data. Most analyzed and interpreted data include amino acid sequences, nucleotide sequences, structures of protein and protein domains. This is what is referred to as computational biology (Baxevanis and Ouellette, 2001). There are two sub disciplines in Bioinformatics and computational biology. One is algorithm and statistics development for the assessment of large data sets. This includes data sets such as gene allocation from a specific sequence, formation of protein families from related protein sequences, protein structure prediction and protein function prediction (Westhead et al. , 2002). The other sub discipline is information management which requires development of tools that allow retrieval, use and management of information (Westhead et al. , 2002). Importance of Bioinformatics Since there is advancement in the world of technology, bioinformatics is to improve the understanding of the so many biological processes. This involves research areas of involvement such as evolutionary biology, gene expression analysis, analysis of cancer mutations, determination of biodiversity, analysis of sequences, comparative genomics, genome annotation and several others (Lesk, 2005). Gene Expression Analysis As this information technology system enables storage of information, analysis and interpretation, gene expression can be performed. This is done by the use of appropriate techniques which measure RNA levels such as sequencing of expressed complementary DNA, Serial Analysis of Gene Expression, micro arrays and so many other techniques. This is important in the determination of genes expressed in certain disorders (Lesk, 2005). Determination of such kinds of genes is important in the development of therapies, as developments have gone further in molecular biology so that disorders can be corrected using gene therapies. An example is gene replacement therapy. When a gene causing a specific disorder or disease is determined, a means of replacing it with a normal one could also be determined (Lesk, 2005). Evolutionary Biology Bioinformatics enables measurement of changes in the DNA of animals therefore determination of origins of evolution of animals from their ancestors. Other ways in which Bioinformatics has enabled researchers to study the origins of organism and animal species is through comparison of their genomes, hence classifying animals that originated from the same ancestor. Bioinformatics through computational models enable prediction of system outcome over a specified period of time (Lesk, 2005). Analysis of Sequences There are so many sequences that decode different proteins. These sequences are made available in the databases. This provides sequences for analysis, for example if a scientist has a sequence of a gene obtained from a species of organism and would like to know the sequence, he/she would check with the sequences in the data bases. In these databases, the information helps determine the genes that encode specific polypeptides and regulatory sequences. Sequence analysis also enables comparison of genes of species hence determination of certain protein functions (Lesk, 2005). Biodiversity Measurement Bioinformatics is also important as it enables measurement of biodiversity of an ecosystem. Biodiversity is all the genomes of all the different species of organisms and animals in an ecosystem. The animals and organismsââ¬â¢ names have therefore to be collected, including their descriptions, genetic information and distribution in a specific ecosystem. There are so many other important information about the organisms that have to be noted alongside the genetic information. These are such as habitat needs, species and population size (Barnes and Gray, 2003). All this information is stored in the databases and is collected for a reason. Several studies that require animal genomic constitution in an ecosystem do take place, therefore need an information source. Information technology has enabled formation of specialized programs of software which are used by the scientists and researchers to retrieve, analyze and share information about their research. This leads to more progress in the field of molecular biology. The importance of this is that it helps in the conservation of the ecosystem. For example, in an ecosystem, there are always those species that are endangered, this can easily be determined by this information technology system of biodiversity determination. Computer simulations has enabled modeling of conservation, population dynamics and calculation of a breeding poolââ¬â¢s genetic health (Barnes and Gray, 2003). Cancer Mutation Analysis Since bioinformatics has enabled storage of sequences of several genes and provided means through which analysis can be carried out, cancer mutations can be detected. Sequences of normal genes are stored in the databases. Determination of a cancer mutation is therefore not difficult as the normal sequence can be compared to the abnormal one and the area of difference marked. This has been used to find out point mutations and other types of mutations. As noted earlier, this is important in cancer therapy (Higgins and Taylor, 2000; (Lesk, 2005). Conclusion Bioinformatics has lead to enormous discoveries due to the provision of information about the genomes of different species, their characteristics and other biological information in the databases. The main issue here is the biological information, how to retrieve it, provision of analysis methods and provision of interpretation methods thereby assisting many studies in many areas. Application of information technology in molecular biology has enabled discoveries of therapies and genetic information about disease causing organisms. This application of information technology is very important as with the changes in the world, evolution is taking place and several different organisms are coming up. Some of these organisms can cause diseases to human and can be a threat if nothing is done about them. Since genome sequences, analysis methods and other important biological information are provided in the programs and databases, determination of the origin of such an organism can be easy and ways of treating it can also be established, therefore eliminating the threat to humans. If for example HIV mutates, like it does, and there are no effective ways of determining the mutation, it means the virus will kill so many people as the new strain has no way to be controlled. Bioinformatics is therefore very important in molecular biology. References Barnes, M. R. and Gray, I. C. (2003). Bioinformatics for Geneticists. US: Wiley. Baxevanis, A. D. and Ouellette, B. F. (2001). Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins. US: Wiley-IEEE. Gibas, C. and Jambeck, P. (2001). Developing Bioinformatics Computer Skills. Oreilly Associates Inc. Higgins, D. and Taylor, W. (2000). Bioinformatics: Sequence, Structure, and Databanks : a Practical Approach. UK: Oxford University Press. Letovsky, S. (1999). Bioinformatics: Databases and Systems. US: Springer. Lesk, A. M. (2005). Introduction to Bioinformatics. UK: Oxford University Press, 2005 Westhead, R. D. , Parish, J. H. and Twyman, M. R. (2002). Bioinformatics. UK: BIOS, 2002 How to cite Bioinformatics, Papers
Subscribe to:
Posts (Atom)